General Information

  • ID:  hor005852
  • Uniprot ID:  Q25060
  • Protein name:  LWS
  • Gene name:  NA
  • Organism:  Hydractinia echinata (Snail fur) (Hermit crab hydroid)
  • Family:  LWamide neuropeptide family
  • Source:  Animal
  • Expression:  Expressed at a low level in mature polyps and planula larvae, and at a high level in primary polyps. |In planula larvae, expressed in a narrow ring of ectodermal neurosensory cells around the widest circumference at the anterior of the larvae. In primary
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Hydractinia (genus), Hydractiniidae (family), Filifera (suborder), Anthoathecata (order), Hydroidolina (subclass), Hydrozoa (class), Cnidaria (phylum), Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  KPPSLWS
  • Length:  7(301-307)
  • Propeptide:  MEKEMRNLMLLVLLTVILDNGIGKCNAKSEEDQDGNARNNRIDKNDDNSDSIEKYLREVTDELSKILAKRIYRDIQLRENNKKAENRQSWIGDLENLDIDSTVQRPPGLWGREADFDNTRAHDSAQISDEKQSGLWVGDAKPPGLWGRDAKPPGLWGRDAKPPGLWGRDAKPPGLWGRDAKPPGLWGRDAKPPGLWGRDAKPPGLWGRDAKPPGLWGGDAKPPGLWGRDAKPPGLWGRDAKPPGLWGRDAKPPGL
  • Signal peptide:  MEKEMRNLMLLVLLTVILDNGIGKCNA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  LWamide peptides may be involved in induction of metamorphosis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q25060-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005852_AF2.pdbhor005852_ESM.pdb

Physical Information

Mass: 92114 Formula: C39H59N9O10
Absent amino acids: ACDEFGHIMNQRTVY Common amino acids: PS
pI: 9.7 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: -82.86 Boman Index: -510
Half-Life / Aliphatic Index: 1.3 hour Aliphatic Index: 55.71
Instability Index: 8665.71 Extinction Coefficient cystines: 5500
Absorbance 280nm: 916.67

Literature

  • PubMed ID:  NA
  • Title:  NA